PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT25286
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 401aa    MW: 45090.2 Da    PI: 5.9543
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT25286genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.92e-12236282147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+ WT+eE++ ++ + + +G g+Wk I++++ +++t+ q+ s+ qk+
         EMT25286 236 RKFWTKEEHKSFLYGLEVYGRGDWKNISKHFVTTKTPVQVSSHAQKF 282
                      678******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.463231287IPR017930Myb domain
SuperFamilySSF466894.16E-16235288IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-9235288IPR009057Homeodomain-like
SMARTSM007171.8E-10235285IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.7E-13235285IPR006447Myb domain, plants
PfamPF002491.3E-8239281IPR001005SANT/Myb domain
CDDcd001675.97E-9239283No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MYDDNDDKNK KHNYIVNSLH ALFPSKTMKQ VTHLYIDLAV EMHMSQRREG THVTSGSPQN  60
IFTFCYPVNG NYELLPMEEN GASSTHGIYT MGDHANENFG VREEATIVDN NGLSFGCAME  120
NTGITVTGEA PLMADNNKMK VLENNISIDQ PVVAPHQWGF WTDEEHSMGG LVNENFEVQE  180
DEGTAMDDNR FSFHCALEDT RIRKTEEAPM MVDKNKMVVL ENNTSVDRPA VAAHQRKFWT  240
KEEHKSFLYG LEVYGRGDWK NISKHFVTTK TPVQVSSHAQ KFFKRIEKKA SSGTKHYSIN  300
DVRLHDNELL AANNSSAPRQ TLSFTSLNND PSYRLQAPTS SFAVMNNLAQ CSPSIYNQQV  360
GQQPMWREQQ MMGSTAAVMG GVGNYVPDGQ QGSAYFYLGN V
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM8CP190.0M8CP19_AEGTA; Myb-like protein J
STRINGMLOC_51337.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.19e-19MYB family protein